PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.271780.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 463aa    MW: 51499.1 Da    PI: 6.6451
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.271780.6genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.91.5e-074044372154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp++e++++L +++gL+ +q+ +WF N+R +
  Cucsa.271780.6 404 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 437
                     469*****************************87 PP

2ELK223.9e-08358379122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+ +Y+++++++++E++
  Cucsa.271780.6 358 ELKHELKSGYKEKIVDIREEIL 379
                     9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.3E-20189233IPR005540KNOX1
PfamPF037907.7E-18191232IPR005540KNOX1
SMARTSM012561.7E-28246301IPR005541KNOX2
PfamPF037913.3E-21250300IPR005541KNOX2
PROSITE profilePS512139.446358378IPR005539ELK domain
PfamPF037897.5E-6358379IPR005539ELK domain
SMARTSM011880.0018358379IPR005539ELK domain
PROSITE profilePS5007111.855378441IPR001356Homeobox domain
SMARTSM003894.0E-11380445IPR001356Homeobox domain
SuperFamilySSF466898.55E-16380445IPR009057Homeodomain-like
CDDcd000862.08E-12381442No hitNo description
Gene3DG3DSA:1.10.10.607.7E-25385442IPR009057Homeodomain-like
PfamPF059201.3E-17398437IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MAYHNHLSQD LPLHFSDHHH QNQPLSDSSS LRNILPDQLP AGHTSPDPKS QQPHHHHHHQ  60
HPLQTAPNWL NNALLRNQNP HSHFSTDTAT TAAAANTNFL NLHTTASDST VSHSSNQWLS  120
RPILHRNHSD VIDDVAAGDA MIGAATAALS HDSGDLKNDA NSGDGLNKSE GMVMEPGAGG  180
EGVLNWQHAR YKAEILAHPL YEQLLSAHVA CLRIATPVDQ LPRIDAQLAQ SQNVVAKYSA  240
LGHSAPPSMV GDDKELDQFM THYVLLLCSF KEQLQQHVRV HAMEAVMACW DIEQSLQSLT  300
GVSPGEGTGA TMSDDDDDQV DSDANVFDGS LDGPDTMGFG PLIPTESERS LMERVRQELK  360
HELKSGYKEK IVDIREEILR KRRAGKLPGD TTSVLKQWWQ SHSKWPYPTE EDKARLVQET  420
GLQLKQINNW FINQRKRNWH SNPSSSTNLK SKRKRYNINS LK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A3e-12381445872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1434454RKRNWHSNPSSSTNLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818610.0LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011654239.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X1
RefseqXP_011654240.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X1
SwissprotO041360.0KNAP3_MALDO; Homeobox protein knotted-1-like 3
TrEMBLA0A0A0L5P60.0A0A0A0L5P6_CUCSA; Uncharacterized protein
STRINGGLYMA04G06810.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-176KNOTTED1-like homeobox gene 3